DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abp1 and Cotl1

DIOPT Version :9

Sequence 1:NP_648657.1 Gene:Abp1 / 39520 FlyBaseID:FBgn0036372 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001101922.1 Gene:Cotl1 / 361422 RGDID:1305498 Length:142 Species:Rattus norvegicus


Alignment Length:209 Identity:53/209 - (25%)
Similarity:76/209 - (36%) Gaps:86/209 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVSFEKNRAQIVAAWKDVLDDKSDTNWSLFGYEGQTNELKVVATGDGGVD------ELNEDLNS 59
            ||...:|...:  ||:..|.||.|...|..|.|:|.|     :..||.|.|      :..:|:. 
  Rat     1 MATKIDKEACR--AAYNLVRDDGSSVIWVTFKYDGAT-----IVPGDQGADYQHFIQQCTDDVR- 57

  Fly    60 GKIMYAFVRIE--DPKTGLNKYLLINWQGEGAPVLRKGTCANHIRDVSNLLSGAHLTINARNEDD 122
               ::||||..  |..:..:|:.||.|.||               |||.|               
  Rat    58 ---LFAFVRFTTGDAMSKRSKFALITWIGE---------------DVSGL--------------- 89

  Fly   123 IDLDRLLKKLSTVSSAYSFKEPRGAMEEQKAPVGTNYTRVIPTKELNASVMQDFWKKEEAEEKLR 187
                                        |:|..||:.|.|   ||    |:|:|.|:....:  |
  Rat    90 ----------------------------QRAKTGTDKTLV---KE----VVQNFAKEFVISD--R 117

  Fly   188 QEAEKESKRLELQK 201
            :|.|::..|.||:|
  Rat   118 KELEEDFIRSELKK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abp1NP_648657.1 ADF_drebrin_like 3..138 CDD:200437 32/142 (23%)
DBINO <173..>207 CDD:290603 10/29 (34%)
SH3_Abp1_eu 476..529 CDD:212893
Cotl1NP_001101922.1 ADF_coactosin_like 9..120 CDD:200438 44/188 (23%)
Flexible and important for F-actin binding. /evidence=ECO:0000250 66..75 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3655
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.