DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abp1 and CG6891

DIOPT Version :9

Sequence 1:NP_648657.1 Gene:Abp1 / 39520 FlyBaseID:FBgn0036372 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_573323.1 Gene:CG6891 / 32865 FlyBaseID:FBgn0030955 Length:163 Species:Drosophila melanogaster


Alignment Length:140 Identity:31/140 - (22%)
Similarity:70/140 - (50%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVSFEKNRAQIVAAWKDVLDDKSDTNWSLFGYEGQTNELKVVATGDGGVDELNEDLNSGKIMYA 65
            :|.|.||:  .|..|::||..|.:||.|::|.::|.  ::.|.|.|. ..:|..:.....:..:.
  Fly    20 LATSLEKD--SIREAYEDVRSDLTDTEWAVFKFDGA--QIIVHARGQ-CFEEFRQQFGDSERAFG 79

  Fly    66 FVRIE--DPKTGLNKYLLINWQGEGAPVLRKGTCANHIRDVSNLLSGAHLTINARNEDDIDLDRL 128
            ::||:  |..:...|::.:.|.|:...|:::...:.....:.::|:...:.:.|..|.::|::..
  Fly    80 YIRIQMGDEMSKRKKFIFLTWIGQEVGVIQRAKMSTDKALIKDVLNNFAVELQAGVEAELDIELF 144

  Fly   129 LKKLSTVSSA 138
            .:.|:....|
  Fly   145 REALNRAGGA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abp1NP_648657.1 ADF_drebrin_like 3..138 CDD:200437 29/136 (21%)
DBINO <173..>207 CDD:290603
SH3_Abp1_eu 476..529 CDD:212893
CG6891NP_573323.1 ADF_coactosin_like 28..139 CDD:200438 24/113 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443060
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3655
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.