DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abp1 and lasp1

DIOPT Version :9

Sequence 1:NP_648657.1 Gene:Abp1 / 39520 FlyBaseID:FBgn0036372 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_997801.1 Gene:lasp1 / 323216 ZFINID:ZDB-GENE-030131-1936 Length:234 Species:Danio rerio


Alignment Length:397 Identity:85/397 - (21%)
Similarity:122/397 - (30%) Gaps:189/397 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PVGTNYTRVI-PTKELNASVMQDFWKKEEAEEKLRQEAEKESKRLELQKLEQEQRSREEKEHKER 217
            |:.:...||: ||:::|.  :..:|             .|.....|:.|:     :...|.:|..
Zfish     3 PLCSRCNRVVYPTEKVNC--LDKYW-------------HKGCFSCEVCKM-----TLNMKNYKGF 47

  Fly   218 EKLVISTTKLQP---AHVPIKTSPQPL--SPEKTAPGFANNLTDAERMRQARNQEARELIGSRVG 277
            ||        :|   ||.| |||...:  :||        ||    |::|....:::.|.     
Zfish    48 EK--------RPYCNAHYP-KTSFTSVADTPE--------NL----RLKQQSKMQSQVLY----- 86

  Fly   278 AAKAMFTKHTSEG--------QLQSKLNTQPPAKPARNSIAQRINVFNQNQPQDAPVPSPPRA-A 333
              |..|.|:..:|        :||....||...    ::|....:........|.|:|..|:. .
Zfish    87 --KEEFEKNKGKGFSVVADTPELQRIKKTQDQI----SNIKYHEDFEKSRSGGDTPLPLTPQLNT 145

  Fly   334 SPAKPLPVEA------PEPVVPAPAIAPAAPVAAEVVSTIAEVEESQPVDDLPLAHESEQFSTIK 392
            .||.|....:      ||||.||.|..|                                     
Zfish   146 PPAYPSSAASQNYHYEPEPVRPAAAAPP------------------------------------- 173

  Fly   393 RSPHSKSNSLQSQSPDETTSSNETDTAVSQEQEEEVRTKVSVTVQQSQSVKSSGMSTLERNALTD 457
              |.|                                                            
Zfish   174 --PSS------------------------------------------------------------ 176

  Fly   458 LVNEDDFICQETLGDLGQRARALYDYQAADETEITFDPGDVITHIDQIDEGWWQG-LGPDGTYGL 521
                            |:|.||:|||.||||.|::|..||:|..:.||||||..| :...|..|:
Zfish   177 ----------------GKRYRAVYDYTAADEDEVSFMDGDMIVDVQQIDEGWMYGRVERTGQQGM 225

  Fly   522 FPANYVE 528
            .||||||
Zfish   226 LPANYVE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abp1NP_648657.1 ADF_drebrin_like 3..138 CDD:200437
DBINO <173..>207 CDD:290603 4/33 (12%)
SH3_Abp1_eu 476..529 CDD:212893 30/54 (56%)
lasp1NP_997801.1 LIM_LASP 5..57 CDD:188831 15/79 (19%)
NEBU 62..92 CDD:128523 9/48 (19%)
NEBU 98..128 CDD:128523 5/33 (15%)
SH3_Lasp1_C 176..234 CDD:212867 32/133 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R73
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.