DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stv and BAG5

DIOPT Version :9

Sequence 1:NP_001097600.1 Gene:stv / 39518 FlyBaseID:FBgn0086708 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001015048.1 Gene:BAG5 / 9529 HGNCID:941 Length:447 Species:Homo sapiens


Alignment Length:176 Identity:42/176 - (23%)
Similarity:76/176 - (43%) Gaps:32/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 EPIINAHKEIPNQNAPPSAQAQAQAQAYAQAQPQAHAAPQQHN----RPTPLNTQAQPEQQVPVE 451
            |.::...:||.|:    ..|||..::.|..::.:......|.:    ...|...:|:....:.|:
Human   280 EKVLKRMREIKNE----LLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQ 340

  Fly   452 G-----------------AAGLPPQTPHTLNSINKIQDIQRDVLELMGKVEQFKGTREEKEYAYL 499
            .                 |....|......|.:..:.:||       |:|..|.|.|.:|.|..|
Human   341 TLITYIDLKEALEKRKLFACEEHPSHKAVWNVLGNLSEIQ-------GEVLSFDGNRTDKNYIRL 398

  Fly   500 DEMLTRNLLKLDTIDTNGKDSIRLARKEAIKCIQASINVLEAKAEE 545
            :|:||:.||.||.:|..|::..:.|||:|::..|..::.|:.|::|
Human   399 EELLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stvNP_001097600.1 BAG 470..541 CDD:280360 25/70 (36%)
BAG5NP_001015048.1 BAG 9..86 CDD:214591
BAG 182..260 CDD:214591
BAG 275..350 CDD:214591 12/73 (16%)
BAG 365..442 CDD:214591 26/83 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158662
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.