DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stv and BAG2

DIOPT Version :9

Sequence 1:NP_001097600.1 Gene:stv / 39518 FlyBaseID:FBgn0086708 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_851246.1 Gene:BAG2 / 836330 AraportID:AT5G62100 Length:296 Species:Arabidopsis thaliana


Alignment Length:166 Identity:43/166 - (25%)
Similarity:64/166 - (38%) Gaps:51/166 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 SINKIQDIQRDVLELMGKVEQF-----KGTR-EEKEYAYLDEMLTRNLLKLDTIDTNGKDSIRLA 524
            |...|.||...|..|.|::..|     ||.: |||....|.|||...|:|||.|  :|...::|.
plant   129 SSKAISDISFQVERLAGQLSAFDTVIGKGGKVEEKNLENLMEMLMNQLVKLDAI--SGDGDVKLK 191

  Fly   525 RK--------------EAIKCIQASINVLEAKAEENAR--------------------AASGAAP 555
            :|              |.:.....::::|:.|   |:|                    .||....
plant   192 KKMQNLMIRFTNCWKEERLHKYVEALDLLKIK---NSRQPQTKPKPQYKEREMLTFYEEASRKPT 253

  Fly   556 APSATAPAVDT------GAVAASEAAGQNAEPVTPQ 585
            |.|::.|.:.|      .:.:||.|..|...||.|:
plant   254 ASSSSPPVIITTRWETFDSSSASTATLQPVRPVHPK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stvNP_001097600.1 BAG 470..541 CDD:280360 26/90 (29%)
BAG2NP_851246.1 BAG1_N 39..109 CDD:176407
BAG 133..219 CDD:280360 25/87 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12329
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.