DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stv and BAG1

DIOPT Version :9

Sequence 1:NP_001097600.1 Gene:stv / 39518 FlyBaseID:FBgn0086708 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_200019.2 Gene:BAG1 / 835281 AraportID:AT5G52060 Length:342 Species:Arabidopsis thaliana


Alignment Length:133 Identity:36/133 - (27%)
Similarity:56/133 - (42%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 IQDIQRDVLELMGKVEQFK------GTREEKEYAYLDEMLTRNLLKLDTIDTNGKDSIRLARKEA 528
            |.||..:|..|.|:|..|:      |...||:...:.|:|...|:|||.|...|  .::|.||..
plant   161 ISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEG--DVKLQRKMQ 223

  Fly   529 IKCIQASINVLEAKAEENARAASGAAPAPSATAPAVDTGAVAASEAAGQNAEPVTPQPQDATKMQ 593
            :|.:|..:..|:|...:|:.|  ......|:||               |...|:.....:..:.|
plant   224 VKRVQNYVETLDALKVKNSMA--NGQQKQSSTA---------------QRLAPIQEHNNEERQEQ 271

  Fly   594 EPI 596
            :||
plant   272 KPI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stvNP_001097600.1 BAG 470..541 CDD:280360 25/76 (33%)
BAG1NP_200019.2 Ubl_AtBAG1_like 66..135 CDD:340574
BAG 161..237 CDD:366957 25/77 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12329
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.