DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stv and Bag5

DIOPT Version :9

Sequence 1:NP_001097600.1 Gene:stv / 39518 FlyBaseID:FBgn0086708 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001311409.1 Gene:Bag5 / 70369 MGIID:1917619 Length:447 Species:Mus musculus


Alignment Length:174 Identity:45/174 - (25%)
Similarity:80/174 - (45%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 EPIINAHKEIPNQNAPPSAQAQAQAQAYAQAQPQAHAAPQQHN----RPTPLNTQAQPEQQVPV- 450
            |.::...:||.|:    ..|||:..:.|.:|:.:......|.:    ...|...:|:....:.| 
Mouse   280 ENVLKRMREIKNE----LLQAQSPPELYLRAKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQ 340

  Fly   451 ------------EGAAGLP--PQTPHTLNSINKIQDIQRDVLELMGKVEQFKGTREEKEYAYLDE 501
                        |.....|  ...||     ..:.:|..::.|::|:|..|.|.|.:|.|..|:|
Mouse   341 ILITYLDLKEALEKRKLFPCEEHPPH-----KAVWEILGNLSEILGEVLSFGGNRTDKNYIRLEE 400

  Fly   502 MLTRNLLKLDTIDTNGKDSIRLARKEAIKCIQASINVLEAKAEE 545
            :||:.||.||.:|..|::..:.|||:|:|..|..::.|:.|::|
Mouse   401 LLTKQLLALDAVDPQGEEKCKAARKQAVKLAQNILSYLDMKSDE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stvNP_001097600.1 BAG 470..541 CDD:280360 26/70 (37%)
Bag5NP_001311409.1 BAG 9..86 CDD:214591
BAG 182..260 CDD:214591
BAG 275..350 CDD:214591 13/73 (18%)
BAG 366..442 CDD:214591 27/80 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849061
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.