DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stv and bag5

DIOPT Version :9

Sequence 1:NP_001097600.1 Gene:stv / 39518 FlyBaseID:FBgn0086708 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_005156743.2 Gene:bag5 / 569580 ZFINID:ZDB-GENE-050913-58 Length:511 Species:Danio rerio


Alignment Length:125 Identity:34/125 - (27%)
Similarity:63/125 - (50%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 HAAPQQHNRPTPLNTQAQPEQQVPVEGAAGLPPQTPHTLNSINKIQDIQRDVLELMGKVEQFKGT 490
            |...|...:..|....|...||.|      .|.|.|    :::::.::|:::..|..:|..:.|.
Zfish    43 HGGQQSQTQQMPGPFAAFAGQQGP------YPGQHP----ALSRLDEVQKEIASLGPQVCSYSGL 97

  Fly   491 REEKEYAYLDEMLTRNLLKLDTIDTNGKDSIRLARKEAIKCIQASINVLEAKAEENARAA 550
            :..:||..|:..|||.||::|.::|.|:..::|.||.|...::..::.||:.|...:|.|
Zfish    98 QNNREYKRLERELTRLLLEVDKVETEGRPELQLPRKRAAGEVEGLLHYLESNATHPSRLA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stvNP_001097600.1 BAG 470..541 CDD:280360 20/70 (29%)
bag5XP_005156743.2 BAG 73..150 CDD:321977 21/76 (28%)
BAG 256..330 CDD:214591
BAG <374..413 CDD:308019
BAG 430..505 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594612
Domainoid 1 1.000 56 1.000 Domainoid score I10988
eggNOG 1 0.900 - - E1_KOG4361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25259
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.