DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stv and agtrap

DIOPT Version :9

Sequence 1:NP_001097600.1 Gene:stv / 39518 FlyBaseID:FBgn0086708 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001015751.1 Gene:agtrap / 548468 XenbaseID:XB-GENE-482876 Length:163 Species:Xenopus tropicalis


Alignment Length:46 Identity:17/46 - (36%)
Similarity:21/46 - (45%) Gaps:8/46 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 YFDDPDFGFPRFSTMGRRGRMAGGANTHMDHDDDFFNRLPSEFRQY 185
            ||  .:.||...|    |.|.:..:..|||...|..|:|||  |.|
 Frog   126 YF--VNLGFITLS----RDRSSYQSIEHMDPPADQDNKLPS--RTY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stvNP_001097600.1 BAG 470..541 CDD:280360
agtrapNP_001015751.1 AGTRAP 1..163 CDD:197883 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165176532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.