DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stv and bag102

DIOPT Version :9

Sequence 1:NP_001097600.1 Gene:stv / 39518 FlyBaseID:FBgn0086708 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_595316.1 Gene:bag102 / 2540564 PomBaseID:SPBC530.03c Length:206 Species:Schizosaccharomyces pombe


Alignment Length:97 Identity:26/97 - (26%)
Similarity:47/97 - (48%) Gaps:9/97 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 LPPQTPHTLNSINKIQDIQRDVLELMGKVEQF-----KGTREEKE-YAYLDEMLTRNLLKLDTID 514
            ||..:|........|.::|:|   |:.|:|.|     ...::.:: :..|.|.|...::|||.::
pombe   112 LPKLSPAMQQIEAYIDELQQD---LVPKIEAFCQSSPASAQDVQDLHTRLSETLLARMIKLDAVN 173

  Fly   515 TNGKDSIRLARKEAIKCIQASINVLEAKAEEN 546
            .......||.|||||:..|..::.|::...:|
pombe   174 VEDDPEARLKRKEAIRLSQQYLSKLDSTKNQN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stvNP_001097600.1 BAG 470..541 CDD:280360 22/76 (29%)
bag102NP_595316.1 BAG 126..200 CDD:280360 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4361
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.