DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and STYXL2

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001073895.1 Gene:STYXL2 / 92235 HGNCID:25034 Length:1158 Species:Homo sapiens


Alignment Length:467 Identity:112/467 - (23%)
Similarity:179/467 - (38%) Gaps:131/467 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WH-MGKVLPGLYVGNYRDSKDHAQLERFKISHII-AIHDSPRRLLPDKH------YLCVMASDTP 59
            |: :.:|.|.:::.....:.:..:|:|..|:||: |.|.:.....|:.:      ||.|...|.|
Human   131 WNEVDEVWPNVFIAEKSVAVNKGRLKRLGITHILNAAHGTGVYTGPEFYTGLEIQYLGVEVDDFP 195

  Fly    60 DQNLSQYFSVCNDFIHAARLR-EGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRA 123
            :.::||:|...::|:..|.|. .|.||:....|:|||..:.|||:|...::...|||..||..||
Human   196 EVDISQHFRKASEFLDEALLTYRGKVLVSSEMGISRSAVLVVAYLMIFHNMAILEALMTVRKKRA 260

  Fly   124 VANPNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNC 188
            : .||.||..||:|..: ||.|||.                       ::|..        ||..
Human   261 I-YPNEGFLKQLRELNE-KLMEERE-----------------------EDYGR--------EGGS 292

  Fly   189 SRGEKCPTGVCNMDPTKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSCPTSPKNSP 253
            :..|: ..|..:|           ..|..|: |..:..:.:||..|.|....|.|:      :.|
Human   293 AEAEE-GEGTGSM-----------LGARVHA-LTVEEEDDSASHLSGSSLGKATQA------SKP 338

  Fly   254 LPIV------------RRSVG--NERIPEDEIVLEQPPTTSREAAEYAAAFEDARREQEQRQLQQ 304
            |.::            ::..|  ::::|:|        .....:|......|:...|..:|.:|:
Human   339 LTLIDEEEEEKLYEQWKKGQGLLSDKVPQD--------GGGWRSASSGQGGEELEDEDVERIIQE 395

  Fly   305 QQQLSRSQRSP--------RPVNSSREAPRVSSAGSRR----ESAAREGNGS------------- 344
            .|  ||::|..        |......|:...||.|.||    ||:|.|...|             
Human   396 WQ--SRNERYQAEGYRRWGREEEKEEESDAGSSVGRRRRTLSESSAWESVSSHDIWVLKQQLELN 458

  Fly   345 ---------AQLQRSASTVSGFGVR----PRSSPAGLHAYT----GSVPSSVHGSRVDLRDAD-- 390
                     |....|.||...:..|    .:.:....||.:    .:..||..||||...|.|  
Human   459 RPDHGRRRRADSMSSESTWDAWNERLLEIEKEASRRYHAKSKREEAADRSSEAGSRVREDDEDSV 523

  Fly   391 --KGSAIYLGCS 400
              :.|:.|..||
Human   524 GSEASSFYNFCS 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 46/143 (32%)
STYXL2NP_001073895.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
DSPc 133..275 CDD:238073 46/142 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..303 8/54 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..337 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..392 5/39 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..444 11/36 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..527 10/34 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..582
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 597..622
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 873..915
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..1135
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.