DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and MSG5

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_014345.3 Gene:MSG5 / 855674 SGDID:S000004998 Length:489 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:51/233 - (21%)
Similarity:78/233 - (33%) Gaps:75/233 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 IHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEF 138
            ||.|..:...:|:||..|:|||.::.|||||....|:..:|...::......:||.|...||.|:
Yeast   305 IHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVAKDISPNMGLIFQLMEW 369

  Fly   139 EQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVCNMDP 203
            ...                                   |.:|        |.||:..|       
Yeast   370 GTM-----------------------------------LSKN--------SPGEEGET------- 384

  Fly   204 TKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSCP--TSPKNSPLPIVRRSVGNERI 266
                         .|........|...||::.|.|||:.:|.|  |:..:||        .:..:
Yeast   385 -------------VHMPEEDDIGNNEVSSTTKSYSSASFRSFPMVTNLSSSP--------NDSSV 428

  Fly   267 PEDEIVLEQPPTTSREAAEYAAAFEDARREQEQRQLQQ 304
            ...|:....|.|.:  .|..|.|.|....::..:.|.|
Yeast   429 NSSEVTPRTPATLT--GARTALATERGEDDEHCKSLSQ 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 23/64 (36%)
MSG5NP_014345.3 DSP_fungal_SDP1-like 230..373 CDD:350371 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.