DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and SDP1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_012153.1 Gene:SDP1 / 854693 SGDID:S000001375 Length:209 Species:Saccharomyces cerevisiae


Alignment Length:102 Identity:31/102 - (30%)
Similarity:47/102 - (46%) Gaps:21/102 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HDSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAY 102
            |||.            :|.|.|.         ....||||..:...:||||..|:|||.|:.:||
Yeast   111 HDSQ------------IALDLPS---------LTSIIHAATTKREKILIHCQCGLSRSATLIIAY 154

  Fly   103 IMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFE 139
            ||...:|:.:.:..::::.....||:.|...||.|:|
Yeast   155 IMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 30/100 (30%)
SDP1NP_012153.1 DSP_fungal_SDP1-like 56..194 CDD:350371 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.