DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and SSH2

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001269058.1 Gene:SSH2 / 85464 HGNCID:30580 Length:1450 Species:Homo sapiens


Alignment Length:533 Identity:104/533 - (19%)
Similarity:188/533 - (35%) Gaps:135/533 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLP---DKHYLCVMASDTPDQNLSQYFS 68
            ::...:::|:..::.:...|:...:.:|:.:........|   :.|.:.|...:..|  |..|::
Human   337 QIFEHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVYDEEATD--LLAYWN 399

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            ....||..|:......|:||..|:|||.:..:||.|.....|...|...|:..|.|..||..|..
Human   400 DTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRTVTKPNPSFMR 464

  Fly   134 QLQEFEQFKLSEERR--RLRERFPSSALE-----------QLDRTKVATALDNYQEL-------- 177
            ||:|::...|:.::|  :|......|.|.           :|::..:.|:.|...|:        
Human   465 QLEEYQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPP 529

  Fly   178 --------------------LQNRDIC---------------EGNCSRGEKCPTGVC-------- 199
                                .:.|.||               |.|.:....|.:|.|        
Human   530 IPPVFVEHMVPQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPL 594

  Fly   200 -NMDPTKGLFR--RRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSCPTSPKNSPLPIVRRSV 261
             |...:|.|.:  ..|..|:....|..:....:|..:.::|.....:...:..|:.|:.      
Human   595 DNCHASKALIQPGHVPEMANKFPDLTVEDLETDALKADMNVHLLPMEELTSPLKDPPMS------ 653

  Fly   262 GNERIPEDEIVLEQPPTTSREAAEYAA---AFEDARREQEQRQLQQQQQLSRSQRSPRPVNSSRE 323
                 |:.|....| |:...|.::::.   .|..|        |::..:||:..|| |..:.|  
Human   654 -----PDPESPSPQ-PSCQTEISDFSTDRIDFFSA--------LEKFVELSQETRS-RSFSHS-- 701

  Fly   324 APRVSSAGSRRESAAREGNGSAQLQRSASTVSGFGVRPRSSPAGLHAYTGSVPSSVHGSRVDLRD 388
              |:...|..|..:.|              :|...|.|....|. ...:.|:.::.|.|.....|
Human   702 --RMEELGGGRNESCR--------------LSVVEVAPSKVTAD-DQRSSSLSNTPHASEESSMD 749

  Fly   389 ADKGSA--------IYLGCSAPRASTL--------SISSSRG--SSGGSAPPSPCHTPPASPRHG 435
            .::..|        |::...:..|.::        |||...|  ...|...|:|||||..:..|.
Human   750 EEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKKNSIHE 814

  Fly   436 --VKRSTSLVKKP 446
              ::|:.:...||
Human   815 LLLERAQTPENKP 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 33/134 (25%)
SSH2NP_001269058.1 SSH-N 38..263 CDD:212166
DEK_C 278..329 CDD:285919
DSPc 335..470 CDD:238073 33/134 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 644..668 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..711 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 723..755 6/32 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 824..852 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 867..889
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 904..981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 989..1008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1046..1068
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1097..1135
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1171..1206
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.