DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and PPS1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_009835.3 Gene:PPS1 / 852579 SGDID:S000000480 Length:807 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:47/205 - (22%)
Similarity:75/205 - (36%) Gaps:68/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQ----LERFKISHIIAIHD---------------SPRRLL------- 45
            ::|..||:|    |.||||    |:...|:||:::.:               .|.|.:       
Yeast   588 RILRHLYLG----SLDHAQNPALLKSLGITHIVSVGEVVSWTLNKDKIAHPVRPHRAITMTNTNE 648

  Fly    46 --------PDKHYLCVMASDTPDQN----LSQY--FSVCN--------------------DFIHA 76
                    ..::....:.||..:..    :|:.  |.:|.                    |||..
Yeast   649 VAGNTTCNKSRNRADTVVSDKQENGSNVVISENSGFQICQIENLDDNGKDPLFHQIDKVLDFISN 713

  Fly    77 ARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR--AVANPNAGFQSQLQEFE 139
            :....|.||:||:.|:|||.||.:|..|.....:...|...||..|  .:..||..|..:|  |:
Yeast   714 SEATGGKVLVHCMVGVSRSATVCIAECMRYLQCDLASAYLFVRVRRLNVIIQPNLFFVYEL--FK 776

  Fly   140 QFKLSEERRR 149
            .:|....|.:
Yeast   777 WWKKHYNREK 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 44/193 (23%)
PPS1NP_009835.3 DSP_fungal_PPS1 580..779 CDD:350366 45/196 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.