Sequence 1: | NP_001261803.1 | Gene: | CG10089 / 39517 | FlyBaseID: | FBgn0036369 | Length: | 447 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009835.3 | Gene: | PPS1 / 852579 | SGDID: | S000000480 | Length: | 807 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 205 | Identity: | 47/205 - (22%) |
---|---|---|---|
Similarity: | 75/205 - (36%) | Gaps: | 68/205 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KVLPGLYVGNYRDSKDHAQ----LERFKISHIIAIHD---------------SPRRLL------- 45
Fly 46 --------PDKHYLCVMASDTPDQN----LSQY--FSVCN--------------------DFIHA 76
Fly 77 ARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR--AVANPNAGFQSQLQEFE 139
Fly 140 QFKLSEERRR 149 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10089 | NP_001261803.1 | DSPc | 4..139 | CDD:238073 | 44/193 (23%) |
PPS1 | NP_009835.3 | DSP_fungal_PPS1 | 580..779 | CDD:350366 | 45/196 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1716 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |