DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and PHS1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_851066.2 Gene:PHS1 / 832437 AraportID:AT5G23720 Length:929 Species:Arabidopsis thaliana


Alignment Length:264 Identity:62/264 - (23%)
Similarity:91/264 - (34%) Gaps:75/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LYVGNYRDSKDHAQLERFKISHIIA-----IHDSPRRLLPDK-HYLCVMASDTPDQNLSQYFSVC 70
            |::|....::....|:...|:|::.     |..|..: .||. .|.....:|..|.|:...|...
plant   711 LFIGGGLAARSIYTLQHLGITHVLCLCANEIGQSDTQ-YPDLFEYQNFSITDDEDSNIESIFQEA 774

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            .|||.......|.:|:||..|.|||.||.:||:|....|...||...:|.....|.||.||...|
plant   775 LDFIKHGEETGGKILVHCFEGRSRSATVVLAYLMLQKKLTLLEAWSKLRKVHRRAQPNDGFARIL 839

  Fly   136 QEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVCN 200
            ...::....:.....|:|.|:..:                                  ||  ||.
plant   840 INLDKKCHGKVSMEWRQRKPTMKV----------------------------------CP--VCG 868

  Fly   201 MDPTKGLFRRRPSNASTHSRLRAQSSNANASSSSL-----------------------SVSSAAA 242
            .:  .||       :|:..:|..|.|:...||.|:                       |.||.:.
plant   869 KN--AGL-------SSSSLKLHLQKSHRKLSSGSVDSAMNMEIQKALEALKLSTGRGSSASSNSF 924

  Fly   243 QSCP 246
            ||.|
plant   925 QSHP 928

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 40/132 (30%)
PHS1NP_851066.2 Act-Frag_cataly 111..426 CDD:370352
DSP 704..841 CDD:350348 40/130 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.