DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and DSPTP1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001189955.1 Gene:DSPTP1 / 821941 AraportID:AT3G23610 Length:228 Species:Arabidopsis thaliana


Alignment Length:131 Identity:54/131 - (41%)
Similarity:78/131 - (59%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKH-YLCVMASDTPDQNLSQYFSVCNDFI 74
            |||:|:...:.:...|:.:.::||:.:..|.|...||.. |..|...|..|.||..||..|.|||
plant    57 GLYLGSVAAASNKNVLKSYNVTHILTVASSLRPAHPDDFVYKVVRVVDKEDTNLEMYFDECVDFI 121

  Fly    75 HAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFE 139
            ..|:.:.|:||:||..|.|||||:.|||:|....:...:||:.|::.|.||:|||||..|||:.|
plant   122 DEAKRQGGSVLVHCFVGKSRSVTIVVAYLMKKHGMTLAQALQHVKSKRPVASPNAGFIRQLQDLE 186

  Fly   140 Q 140
            :
plant   187 K 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 53/128 (41%)
DSPTP1NP_001189955.1 DSPc 51..186 CDD:238073 53/128 (41%)
CDC14 53..191 CDD:225297 54/131 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.