DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and MKP2

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001189821.1 Gene:MKP2 / 819784 AraportID:AT3G06110 Length:167 Species:Arabidopsis thaliana


Alignment Length:137 Identity:48/137 - (35%)
Similarity:79/137 - (57%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKH-YLCVMASDTPDQNLSQYFS 68
            :.::..||::|:..::.:...|:...|:|::.:..:.....||.. |..:...|..:.:|:.||.
plant    25 LSEIQQGLFIGSVAEANNKDFLKSSNITHVLTVAVALAPPYPDDFVYKVIEVVDRSETDLTVYFD 89

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            .|..||..|....|.||:||..|||||||:.|||:|....:.:.:|:::||:.|..|.||.||.|
plant    90 ECYSFIDQAIQSGGGVLVHCFMGMSRSVTIVVAYLMKKHGMGFSKAMELVRSRRHQAYPNPGFIS 154

  Fly   134 QLQEFEQ 140
            |||:||:
plant   155 QLQQFEK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 46/134 (34%)
MKP2NP_001189821.1 DSP 26..158 CDD:350348 45/131 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.