DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and IBR5

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_178534.2 Gene:IBR5 / 814997 AraportID:AT2G04550 Length:257 Species:Arabidopsis thaliana


Alignment Length:149 Identity:41/149 - (27%)
Similarity:66/149 - (44%) Gaps:34/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPG-LYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKHYLCVMASDTPDQNLSQ----Y 66
            ::||. ||:|:|.::.....|:...||.::       ..:|    :|        |||.:    |
plant    52 EILPEFLYLGSYDNASRSELLKTQGISRVL-------NTVP----MC--------QNLYRNSFTY 97

  Fly    67 FSVCND----------FIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAG 121
            ..:.|:          |:......:..||:||::|.|||..|.|||:|........|:.:.|:..
plant    98 HGLDNEKVLQFDDAIKFLDQCEKDKARVLVHCMSGKSRSPAVVVAYLMKRKGWRLAESHQWVKQR 162

  Fly   122 RAVANPNAGFQSQLQEFEQ 140
            |...:.:..|..|||||||
plant   163 RPSTDISPEFYQQLQEFEQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 38/146 (26%)
IBR5NP_178534.2 DSPc 50..180 CDD:238073 38/146 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.