DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp28

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_003750786.3 Gene:Dusp28 / 684024 RGDID:1595220 Length:163 Species:Rattus norvegicus


Alignment Length:135 Identity:43/135 - (31%)
Similarity:66/135 - (48%) Gaps:1/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAI-HDSPRRLLPDKHYLCVMASDTPDQNLSQYFSVC 70
            :|.|.|::||.|.:.....|.|..|:..:.: ...|....|....|.|...|.|.::|..:....
  Rat    13 RVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPGPRAPGVAELRVPVFDDPAEDLLTHLEPT 77

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            ...:.||....|:.|::|..|.|||..|..||:|.....:...|.::|::.|.||.||.||.:||
  Rat    78 CAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDCAFQMVKSARPVAEPNLGFWAQL 142

  Fly   136 QEFEQ 140
            |::||
  Rat   143 QKYEQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 41/132 (31%)
Dusp28XP_003750786.3 DUSP28 11..150 CDD:350422 43/135 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.