DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp6

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_080544.1 Gene:Dusp6 / 67603 MGIID:1914853 Length:381 Species:Mus musculus


Alignment Length:137 Identity:53/137 - (38%)
Similarity:79/137 - (57%) Gaps:3/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDK---HYLCVMASDTPDQNLSQYFS 68
            ::||.||:|..:||.:...||.|.|.:|:.:..:...|..:.   .|..:..||...|||||:|.
Mouse   209 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFP 273

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            ....||..||.:...||:|||||:||||||.|||:|...:|:..:|..:|:..::..:||..|..
Mouse   274 EAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMG 338

  Fly   134 QLQEFEQ 140
            ||.:||:
Mouse   339 QLLDFER 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 51/134 (38%)
Dusp6NP_080544.1 DSP_MapKP 18..147 CDD:238723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..203
CDC14 204..356 CDD:225297 53/137 (39%)
DSPc 207..344 CDD:238073 51/134 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.