DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp10

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001099204.1 Gene:Dusp10 / 63995 RGDID:1310844 Length:482 Species:Rattus norvegicus


Alignment Length:142 Identity:51/142 - (35%)
Similarity:78/142 - (54%) Gaps:15/142 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLPGLYVGNYRDSKDHAQLERFKISHIIAI--HDSPRRLLPDKH-------YLCVMASDTPDQNL 63
            :||.|::||.:|::|...::|..:.::|.:  |      ||..|       |..:.|:|:..|||
  Rat   325 ILPFLFLGNEQDAQDLDAMQRLNVGYVINVTTH------LPLYHYEKGLFNYKRLPATDSNKQNL 383

  Fly    64 SQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPN 128
            .|||....:||..|......:||||.||:|||.|:.:||:|..|.:...:|.|.|:..|.:.:||
  Rat   384 RQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPN 448

  Fly   129 AGFQSQLQEFEQ 140
            ..|..||.|||:
  Rat   449 LNFMGQLLEFEE 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 49/139 (35%)
Dusp10NP_001099204.1 DSP_MapKP 149..284 CDD:238723
DSP_DUSP10 322..473 CDD:350415 51/142 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.