DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp10

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_071302.2 Gene:Dusp10 / 63953 MGIID:1927070 Length:483 Species:Mus musculus


Alignment Length:148 Identity:53/148 - (35%)
Similarity:80/148 - (54%) Gaps:15/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NWHMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAI--HDSPRRLLPDKH-------YLCVMASD 57
            |..:..:||.|::||.:|::|...::|..|.::|.:  |      ||..|       |..:.|:|
Mouse   320 NAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTH------LPLYHYEKGLFNYKRLPATD 378

  Fly    58 TPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR 122
            :..|||.|||....:||..|......:||||.||:|||.|:.:||:|..|.:...:|.|.|:..|
Mouse   379 SNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKR 443

  Fly   123 AVANPNAGFQSQLQEFEQ 140
            .:.:||..|..||.|||:
Mouse   444 PIISPNLNFMGQLLEFEE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 50/143 (35%)
Dusp10NP_071302.2 DSP_MapKP 150..285 CDD:238723
Interaction with MAP kinases. /evidence=ECO:0000250 200..216
DSP_DUSP10 323..474 CDD:350415 52/145 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.