DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp4

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_071535.1 Gene:Dusp4 / 60587 RGDID:620625 Length:395 Species:Rattus norvegicus


Alignment Length:240 Identity:60/240 - (25%)
Similarity:96/240 - (40%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAI-HDSPRRLLPDKHYLCVMASDTPDQNLSQYFSVC 70
            ::||.||:|:...:.....|:...|:.::.: .|.|........|.|:...|....::|.:|...
  Rat   199 EILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEA 263

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            .::|.|.:...|.||:||.||:|||.|:.:||:|....:..:||.:.|:..|::.:||..|..||
  Rat   264 IEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 328

  Fly   136 QEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVCN 200
            .:||...|:.. .......||..|.:                            ||:..||    
  Rat   329 LQFESQVLTTS-CAAEAASPSGPLRE----------------------------RGKATPT---- 360

  Fly   201 MDPTKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSC 245
              ||.......|.:...|    |..||.....|.::.|    .||
  Rat   361 --PTSQFVFSFPVSVGVH----AAPSNLPYLHSPITTS----PSC 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 39/132 (30%)
Dusp4NP_071535.1 DSP_MapKP 9..159 CDD:238723
DSPc 196..332 CDD:238073 39/132 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.