DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and si:ch211-121a2.2

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001098581.1 Gene:si:ch211-121a2.2 / 564515 ZFINID:ZDB-GENE-070705-21 Length:449 Species:Danio rerio


Alignment Length:194 Identity:53/194 - (27%)
Similarity:93/194 - (47%) Gaps:28/194 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNW-HMGKVLPGLYVGNYRDSKDHAQLERFKISHI-------IAIHDS--PRRLL---PDKHYLC 52
            ::| .:.:|.|.:::||...:.|.|.|:...|:||       :.:|.:  ||.|.   .|..|..
Zfish    76 LDWTPVTEVWPNVFLGNEETALDRAMLKTMGITHILNAAEIEVDLHANIIPRELHYQGMDITYYN 140

  Fly    53 VMASDTPDQNLSQYFSVCNDFIHAARLR-EGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALK 116
            |.|.|....::|:||....:||:.|... |..||:||:.|:|||.|:.:||:|....:..:.|:.
Zfish   141 VPALDEDMFDISEYFFPAAEFINKALSNPENKVLVHCVQGVSRSATLFLAYLMIQHDIMVENAID 205

  Fly   117 VVRAGRAVANPNAGFQSQLQEFEQFKLSEERRRLRERF-------------PSSALEQLDRTKV 167
            .|...|.: :||.||..||.......:.:.:.:|||:.             |..:.::::.|.:
Zfish   206 HVTGVRWI-SPNMGFLKQLTALNSTLVEKRKLQLREQLKRGNEDTEKPIPEPQESKQRIEETVI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 47/147 (32%)
si:ch211-121a2.2NP_001098581.1 CDC14 61..244 CDD:225297 51/168 (30%)
DSPc 80..223 CDD:238073 45/143 (31%)
DSPc 284..438 CDD:238073
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.