DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Styx

DIOPT Version :10

Sequence 1:NP_648654.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_062611.2 Gene:Styx / 56291 MGIID:1891150 Length:223 Species:Mus musculus


Alignment Length:153 Identity:52/153 - (33%)
Similarity:82/153 - (53%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNGMNKVLPGLYVGNYRDSKDHAQ--LERFKISHIIAIHDS--PRRLLPD----KHYLCVMASD 57
            |...|.:|||||::|.|..:.....  |::..|:|||.|..:  ...:.|:    ..||.:..:|
Mouse    25 MRREMQEVLPGLFLGPYSSAMKSKLPILQKHGITHIICIRQNIEANFIKPNFQQLFRYLVLDIAD 89

  Fly    58 TPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR 122
            .|.:|:.::|.:..:||..:....|.||:|..||:|||....:||||....:.:::|...|:..|
Mouse    90 NPVENIIRFFPMTKEFIDGSLQNGGKVLVHGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERR 154

  Fly   123 AVANPNAGFQSQLQEFEQFKLSE 145
            ...||||||..||||:|...|::
Mouse   155 FCINPNAGFVHQLQEYEAIYLAK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_648654.1 DSP_DUSP22_15 5..140 CDD:350369 49/142 (35%)
StyxNP_062611.2 DSP_STYX 25..175 CDD:350372 51/149 (34%)
Interaction with FBXW7. /evidence=ECO:0000250|UniProtKB:Q8WUJ0 76..78 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..223
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.