DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and styx

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001019561.1 Gene:styx / 554088 ZFINID:ZDB-GENE-050522-45 Length:224 Species:Danio rerio


Alignment Length:155 Identity:51/155 - (32%)
Similarity:80/155 - (51%) Gaps:12/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNWHMGKVLPGLYVGNYRDSKDH--AQLERFKISHIIAIHD-------SPRRLLPDK-HYLCVMA 55
            |...|.::||||::|.|..:...  :.||:..|:||:.:..       .|.  .|.| .||.:..
Zfish    26 MRREMQEILPGLFLGPYSAAMKSKLSMLEKQGITHIVCVRQDIEANFIKPN--FPHKFRYLVLDI 88

  Fly    56 SDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRA 120
            :|.|.:|:.:||....:||.......|.||:|..||:|||..:.:||:|....:.:::|...|:.
Zfish    89 ADNPVENIIRYFPTTKEFIDGCLETGGKVLVHGNAGISRSAALVIAYLMETFGVKYRDAFSHVQE 153

  Fly   121 GRAVANPNAGFQSQLQEFEQFKLSE 145
            .|...|||.||..||||:|...|::
Zfish   154 RRFCINPNVGFVHQLQEYEAIYLAK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 48/144 (33%)
styxNP_001019561.1 DSPc 29..172 CDD:238073 48/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1042
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.