DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and dusp5

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001015856.1 Gene:dusp5 / 548573 XenbaseID:XB-GENE-957572 Length:375 Species:Xenopus tropicalis


Alignment Length:229 Identity:65/229 - (28%)
Similarity:99/229 - (43%) Gaps:36/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKIS-HIIAIHDSPRRLLPDKHYLC--------VMASDTPDQN 62
            ::||.||:|    |..||....|..: ||.|:.:..|:...|   ||        :...|....:
 Frog   173 EILPFLYLG----SAYHASRCEFLANLHITALLNVSRKSSSD---LCKEQYSYKWIPVEDNHTAD 230

  Fly    63 LSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANP 127
            :|.:|....|||...:...|.||:||.||:|||.|:.:||:|.......:||.:.::..|::.:|
 Frog   231 ISSHFQEAIDFIDTIKRAGGRVLVHCEAGISRSPTICMAYLMKTRRFRLEEAFEYIKQRRSLISP 295

  Fly   128 NAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGE 192
            |..|..||..:|.           |.|||..|..:...| ..::..:.:.|......||:|.   
 Frog   296 NFSFMGQLLHYES-----------EIFPSKVLAPVVSCK-RDSVSFFSDELNIGKSYEGSCF--- 345

  Fly   193 KCPTGVCNMDPTKGLFRRRPSNASTHSRLRAQSS 226
            ..||.|.:..|.     |.|.:....|.:.|.||
 Frog   346 TFPTSVLSPVPL-----RSPVHQLKLSPITATSS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 44/140 (31%)
dusp5NP_001015856.1 DSP_MapKP 6..135 CDD:238723
DSP_DUSP5 171..309 CDD:350487 45/153 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.