DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and STYXL1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_016867785.1 Gene:STYXL1 / 51657 HGNCID:18165 Length:351 Species:Homo sapiens


Alignment Length:161 Identity:38/161 - (23%)
Similarity:64/161 - (39%) Gaps:41/161 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPG-LYVGNYRDSKDHAQLERFKI-SHI-------------------IAIHDSPR-RLLPDKH 49
            :::|| ::|||:..:.|....:..|| :|:                   |.|.|||. ::||...
Human   200 EIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLR 264

  Fly    50 YLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEA 114
            ::|                   .||.........:||....|:|||....:||:|.:.....:.:
Human   265 HMC-------------------HFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRS 310

  Fly   115 LKVVRAGRAVANPNAGFQSQLQEFEQFKLSE 145
            ...|:..:....||.|..|||.|:|:..|.:
Human   311 WAYVKKCKNNMCPNRGLVSQLLEWEKTILGD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 36/153 (24%)
STYXL1XP_016867785.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.