DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp27

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001178858.1 Gene:Dusp27 / 498267 RGDID:1560598 Length:1137 Species:Rattus norvegicus


Alignment Length:422 Identity:97/422 - (22%)
Similarity:156/422 - (36%) Gaps:113/422 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHII-AIHDSPRRLLPDKH------YLCVMASDTPDQNLS 64
            :|.|.:::.....:.:..:|:|..|:||: |.|.:.....|:.:      ||.|...|.|:.::|
  Rat   136 EVWPNVFIAEKSVAVNKGRLKRLGITHILNAAHGTGVYTGPEFYTGLEIQYLGVEVDDFPEVDIS 200

  Fly    65 QYFSVCNDFIHAARLR-EGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPN 128
            |:|....:|:..|.|. .|.||:....|:|||..:.|||:|...::...|||..||..||: .||
  Rat   201 QHFRKAAEFLDEALLTYRGKVLVSSEMGISRSAVLVVAYLMIFHNMAILEALMTVRRKRAI-YPN 264

  Fly   129 AGFQSQLQEFEQFKLSEERRR--------------LRERFPSSALEQLDR--------------- 164
            .||..||:|..: ||.|||..              |..|..|..:|:.|.               
  Rat   265 DGFLKQLRELNE-KLMEEREEEDDEEEPEEDAGSTLGARVNSLMVEEEDDATSHLSGSSLGKASQ 328

  Fly   165 -TKVATALDNYQ-----------------ELLQNRDICEGNCSR-----GEKCPTGVCNMDPTKG 206
             ::..|.:|..:                 |..|.|   :|:||.     |:.|..|.......:.
  Rat   329 VSQPVTLIDEEEEERLYEEWRKGQGFPKAEASQGR---KGSCSASSEQDGDDCEDGAVERIIQEW 390

  Fly   207 LFRRRPSNASTHSRLRAQSSNANASS-------SSLSVSSAAAQSCPTSPKNSPLPIVRRSVGNE 264
            ..|.....|..|.:...:......:|       .:||.|||:                 .||.:.
  Rat   391 QSRNERYQAKGHKQWNREEDEEEENSYTSRRRRHTLSESSAS-----------------ESVSSH 438

  Fly   265 RIPEDEIVLEQPPTTSREAAEYAAAFEDARREQEQRQLQQQQQLSRSQRSPRPVNSSREAPRVSS 329
            .|   .::.:|...||:.            |....|...:..:.:....:.|.|...:||.|...
  Rat   439 DI---RVLKQQLKRTSQS------------RHDRHRSDSESTESTWDMWNERLVEIEKEAARKYR 488

  Fly   330 AGSRRE---------SAAREGNGSAQLQRSAS 352
            :.|:||         |..||.:..:.|..::|
  Rat   489 SKSKREELDADSEAGSRVREDDEESVLSEASS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 46/139 (33%)
Dusp27NP_001178858.1 DSPc 133..275 CDD:238073 46/139 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.