DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and dusp22

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_012820032.1 Gene:dusp22 / 496452 XenbaseID:XB-GENE-486791 Length:212 Species:Xenopus tropicalis


Alignment Length:175 Identity:77/175 - (44%)
Similarity:110/175 - (62%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLP---DKHYLCVMASDTPDQNLSQY 66
            |.|:||.|::||::|::|..||.:..|:||::||||.|.:|.   ...|||:.|||:|.|||.|:
 Frog     5 MNKILPSLFIGNFKDARDVEQLHKNNITHILSIHDSARPMLEVSGGMKYLCIPASDSPSQNLIQH 69

  Fly    67 FSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGF 131
            |.....|||..||:....|:|||||:|||||:.|||:||.|...|::||..||..|..||||.||
 Frog    70 FKDSIAFIHECRLKGEGCLVHCLAGVSRSVTLVVAYVMTVTDFGWEDALSAVRGARTCANPNMGF 134

  Fly   132 QSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQE 176
            |.||::|.:..:.:.|..|:|.:..:.....|..|  ..||.:::
 Frog   135 QKQLEDFGKHDVYQFRTWLKETYGENPFNDKDDAK--QLLDKHKQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 69/136 (51%)
dusp22XP_012820032.1 DSPc 4..141 CDD:238073 69/135 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4574
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H86039
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0002529
OrthoInspector 1 1.000 - - otm47646
Panther 1 1.100 - - LDO PTHR45948
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1042
SonicParanoid 1 1.000 - - X2698
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.