DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and styxl1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001004619.1 Gene:styxl1 / 447880 ZFINID:ZDB-GENE-040912-45 Length:295 Species:Danio rerio


Alignment Length:179 Identity:46/179 - (25%)
Similarity:83/179 - (46%) Gaps:26/179 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNWHMGKVLPG-LYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKH--YLCVMASDTPDQN 62
            :|.:..::||| ||:|:||.:.:...|:..|::.|:.:.:....:....:  .|.:..:|:.:.:
Zfish   138 LNLYPVEILPGQLYMGDYRQATNLKVLKDLKLNAIVNVSNDCSLIFKKANCTVLHIRVADSAEAD 202

  Fly    63 LSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNW--KEALKVVRAGRAVA 125
            |...|.....||::......:||:....|.||...||:||:|  :||.:  |||...::..:|..
Zfish   203 LVTSFERICVFINSHLNNASSVLVFSTLGKSRCCAVAMAYLM--SHLKYTIKEAWNHIQQCKANM 265

  Fly   126 NPNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNY 174
            .||.||..||.::|                   |:.|.:....|:..||
Zfish   266 RPNRGFVQQLSDWE-------------------LQTLGKRVTDTSEPNY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 39/139 (28%)
styxl1NP_001004619.1 RHOD 33..121 CDD:294087
PTPc 142..279 CDD:304379 39/138 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.