DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and CG15528

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster


Alignment Length:124 Identity:44/124 - (35%)
Similarity:71/124 - (57%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQLERFKISHII----AIHDSPRRLLPDKH---YLCVMASDTPDQNLSQYFSVCNDFIHAARLRE 81
            |.:::..:|.:|    .:.|:|   ||.:.   ||.:||.|..:.:|:::|....|.|....|..
  Fly    62 AYMDKLGVSCVINVAPELPDTP---LPSQKNPLYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSG 123

  Fly    82 GNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQ 140
            |..||||:||:|||.::.:||:|....::.:||.|.|:|.|....||:||..||:.:||
  Fly   124 GCTLIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 42/121 (35%)
CG15528NP_651767.2 DSPc 43..181 CDD:238073 42/121 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462499
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.