DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dupd1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_036014638.1 Gene:Dupd1 / 435391 MGIID:3647127 Length:226 Species:Mus musculus


Alignment Length:160 Identity:51/160 - (31%)
Similarity:85/160 - (53%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHII-AIH-----DSPRRLLPDKH------YLCVMAS 56
            |:.:|.|.|::|:...:.|...|::...:|:: |.|     |:.    ||.:      |..|.|.
Mouse    64 HVNEVWPRLHIGDEATALDRYGLQKAGFTHVLNAAHGRWNVDTG----PDYYRDMAIEYHGVEAD 124

  Fly    57 DTPDQNLSQYFSVCNDFIHAARLRE--GNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVR 119
            |.|..:||.:|.....||.:| ||:  ..:|:||..|.|||.|:.:||:|...::...:|::.|.
Mouse   125 DVPTFDLSIFFYSAAAFIDSA-LRDDHSKILVHCAMGRSRSATLVLAYLMIHKNMTLVDAIQQVA 188

  Fly   120 AGRAVANPNAGFQSQLQEFEQFKLSEERRR 149
            ..|.|. ||.||..||:|.:: :|.::||:
Mouse   189 KNRCVL-PNRGFLKQLRELDK-QLVKQRRQ 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 48/148 (32%)
Dupd1XP_036014638.1 DUPD1 55..214 CDD:350423 49/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.