DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and dusp4

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_957465.1 Gene:dusp4 / 394146 ZFINID:ZDB-GENE-040426-709 Length:367 Species:Danio rerio


Alignment Length:275 Identity:63/275 - (22%)
Similarity:104/275 - (37%) Gaps:84/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDS-PRRLLPDKHYLCVMASDTPDQNLSQYFSVC 70
            ::||.|::|:...:.....|:|..||.::.:..: |.....|..|.|:...|...:::|.:|...
Zfish   173 EILPFLFLGSALHASKKDMLDRMGISALLNVSSNCPNHFEGDYQYKCIPVEDNHKEDISSWFIEA 237

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            .:||.:.:...|.||:||.||:|||.|:.:||:|....:..:||.:.|:..|::.:||..|..||
Zfish   238 IEFIDSVKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 302

  Fly   136 QEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVCN 200
            .:||                                                             
Zfish   303 LQFE------------------------------------------------------------- 306

  Fly   201 MDPTKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSCPTSPKNSPLPIVRRSVGNER 265
                              |::.|.|.:..|:|.|.|:...:: |.||||.....|:   ||....
Zfish   307 ------------------SQVLATSCSVEAASPSASLGPKSS-STPTSPFIFSFPM---SVVTHN 349

  Fly   266 IPEDEIVLEQPPTTS 280
            .|.....|:.|.|||
Zfish   350 QPGSLTYLQSPITTS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 40/132 (30%)
dusp4NP_957465.1 DSP_MapKP 9..139 CDD:238723
DSPc 170..306 CDD:238073 40/132 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.