DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp15

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001102068.2 Gene:Dusp15 / 362238 RGDID:1305990 Length:244 Species:Rattus norvegicus


Alignment Length:270 Identity:98/270 - (36%)
Similarity:136/270 - (50%) Gaps:63/270 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKHYLCVMASDTPDQNLSQYFSV 69
            |.|||||||:||:.|:||..||.|.||:||::||:||:.||.|..||.:..||||:..:.::|..
  Rat     5 MTKVLPGLYLGNFIDAKDPDQLGRNKITHIVSIHESPQPLLQDITYLRISVSDTPEVPIKKHFKE 69

  Fly    70 CNDFIHAARLREGNVLIHCL--------AGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVAN 126
            |..|||:.||..||.|:|||        ||:|||.||.:||:||.|.|.|:|.|:.::|.|.:||
  Rat    70 CVHFIHSCRLNGGNCLVHCLSFTSGSFFAGISRSTTVVIAYVMTVTGLGWQEVLEAIKASRPIAN 134

  Fly   127 PNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRG 191
            ||.||:.||:||......:.||:|.|||........:..:....|                |.| 
  Rat   135 PNPGFRQQLEEFGWANSQKLRRQLEERFGEIPFRDEEDLRALLPL----------------CRR- 182

  Fly   192 EKCPTGVCNMDPTKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQS-----CPTSPKN 251
                   |...|                        ..::.|:.:.||||::.     .|.||:.
  Rat   183 -------CRQGP------------------------GTSAPSATTASSAASEGTLQRLVPRSPRE 216

  Fly   252 S--PLPIVRR 259
            |  |||::.|
  Rat   217 SHRPLPLLAR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 73/141 (52%)
Dusp15NP_001102068.2 DSPc 4..146 CDD:238073 72/140 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4135
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0002529
OrthoInspector 1 1.000 - - otm44612
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45948
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2698
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.