DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp22

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_017456091.2 Gene:Dusp22 / 361242 RGDID:1307146 Length:211 Species:Rattus norvegicus


Alignment Length:223 Identity:95/223 - (42%)
Similarity:135/223 - (60%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCN 71
            |:|||||:||::|::|..||.|.|::||:::||:.|.:|....|||:.|:|:|.|||:::|....
  Rat    13 KILPGLYIGNFKDARDAEQLSRNKVTHILSVHDTARPMLEGVKYLCIPAADSPSQNLTRHFKESI 77

  Fly    72 DFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQ 136
            .|||..||:....|:|||||:|||||:.:|||||.|...|:|||..|||||:.||||.|||.|||
  Rat    78 KFIHECRLQGEGCLVHCLAGVSRSVTLVIAYIMTVTDFGWEEALHTVRAGRSCANPNLGFQRQLQ 142

  Fly   137 EFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVCNM 201
            |||:.::.:.|:.|||.:..:.|...:..|  :.|..|:|  |.|                   |
  Rat   143 EFEKHEVRQYRQWLREEYGENPLRDAEEAK--SILGKYKE--QGR-------------------M 184

  Fly   202 DPTKGLFRRRPSNA--STHSRLRAQSSN 227
            :|       |||:.  |:.|.|.|.:.|
  Rat   185 EP-------RPSSRRWSSLSALPALTYN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 72/131 (55%)
Dusp22XP_017456091.2 DUSP22 13..156 CDD:350429 75/142 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4135
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H86039
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0002529
OrthoInspector 1 1.000 - - otm44612
orthoMCL 1 0.900 - - OOG6_106251
Panther 1 1.100 - - LDO PTHR45948
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2698
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.