DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp29

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001101838.1 Gene:Dusp29 / 361003 RGDID:1310229 Length:215 Species:Rattus norvegicus


Alignment Length:160 Identity:51/160 - (31%)
Similarity:85/160 - (53%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHII-AIH-----DSPRRLLPDKH------YLCVMAS 56
            |:.:|.|.|:||:...:.|...|::...:|:: |.|     |:.    ||.:      |..|.|.
  Rat    53 HVNEVWPRLHVGDEATALDRYGLQKAGFTHVLNAAHGRWNVDTG----PDYYRDMAIEYHGVEAD 113

  Fly    57 DTPDQNLSQYFSVCNDFIHAARLRE--GNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVR 119
            |.|..:||.:|.....||.:| |::  ..:|:||..|.|||.|:.:||:|...::...:|::.|.
  Rat   114 DVPTFDLSIFFYSAAAFIDSA-LQDDHSKILVHCAMGRSRSATLVLAYLMIHKNMTLVDAIQQVA 177

  Fly   120 AGRAVANPNAGFQSQLQEFEQFKLSEERRR 149
            ..|.|. ||.||..||:|.:: :|.::||:
  Rat   178 KNRCVL-PNRGFLKQLRELDK-QLVKQRRQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 48/148 (32%)
Dusp29NP_001101838.1 DSPc 53..196 CDD:238073 48/148 (32%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q68J44 145..152 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.