DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp13

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_008768696.2 Gene:Dusp13 / 361002 RGDID:1359712 Length:391 Species:Rattus norvegicus


Alignment Length:160 Identity:48/160 - (30%)
Similarity:86/160 - (53%) Gaps:19/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH------DSPRRL---LPDKHYLCVMASDTP 59
            |:.:|.|.|::|:...::|.::|.:..|:|::.:.      |:..:.   .|.::| .:.|.|.|
  Rat   238 HINEVWPNLFLGDAYAARDKSRLIQLGITHVVNVAAGKFQVDTGAKFYRGTPVEYY-GIEADDNP 301

  Fly    60 DQNLSQYF----SVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRA 120
            ..:||.||    ....|.::..|.|   ||:||..|:|||.|:.:|::|...::...:|::.|:|
  Rat   302 FFDLSVYFLPVARYIRDALNTPRSR---VLVHCAMGVSRSATIVLAFLMIFENMTLVDAIQTVQA 363

  Fly   121 GRAVANPNAGFQSQLQEFEQFKLSEERRRL 150
            .|.:. ||:||..|||..:. :|..|..||
  Rat   364 HRDIC-PNSGFLRQLQVLDN-RLRRETGRL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 44/147 (30%)
Dusp13XP_008768696.2 PTP_DSP_cys 221..384 CDD:421693 44/151 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.