DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Styxl1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001032877.2 Gene:Styxl1 / 360792 RGDID:1305845 Length:321 Species:Rattus norvegicus


Alignment Length:144 Identity:41/144 - (28%)
Similarity:68/144 - (47%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPG-LYVGNYR---DSKDHAQLERFKI-SHI-IAIHDSPRRLLPDKHYLCVMASDTPDQNLSQ 65
            :::|| :::|...   ::|.|..|   || :|: |::..:|..:......|.:...||||..|..
  Rat   170 EIVPGKVFLGKLSQACNAKMHKDL---KIKAHVNISLETTPYFVGNVDKLLHIKIEDTPDSILFP 231

  Fly    66 YFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALK----VVRAGRAVAN 126
            .|...:.||.........:|:....|:||||...||::|   |.| :|.||    .|:..:....
  Rat   232 SFRHISHFIELHLKLRSVILVFSTRGISRSVAAVVAFLM---HYN-EETLKRSWAHVKKCKTNMR 292

  Fly   127 PNAGFQSQLQEFEQ 140
            ||....:||.|:|:
  Rat   293 PNRALVAQLLEWEK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 40/141 (28%)
Styxl1NP_001032877.2 RHOD 33..146 CDD:412175
PTP_DSP_cys 158..311 CDD:421693 41/144 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.