DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp9

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001033062.1 Gene:Dusp9 / 293847 RGDID:1565535 Length:414 Species:Rattus norvegicus


Alignment Length:145 Identity:56/145 - (38%)
Similarity:84/145 - (57%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLP---DKHYLCVMASDTPDQNLSQYFS 68
            ::||.||:|:.|||.:...|.:..|.:|:.:..:...|..   |.||..:..||...|||||:|.
  Rat   236 QILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNLFEKNGDFHYKQIPISDHWSQNLSQFFP 300

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            ....||..|..:...||:|||||:||||||.|||:|...:|:..:|..:|:..::..:||..|..
  Rat   301 EAIAFIDEALSQNCGVLVHCLAGVSRSVTVTVAYLMQKLNLSLNDAYDLVKRKKSNISPNFNFMG 365

  Fly   134 QLQEFEQ-FKLSEER 147
            ||.:||: .:|.|:|
  Rat   366 QLLDFERSLRLGEKR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 51/134 (38%)
Dusp9NP_001033062.1 DSP_MapKP 5..168 CDD:238723
DSPc 234..371 CDD:238073 51/134 (38%)
CDC14 <254..372 CDD:225297 44/117 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.