DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and SPBC17A3.06

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_595588.1 Gene:SPBC17A3.06 / 2540146 PomBaseID:SPBC17A3.06 Length:330 Species:Schizosaccharomyces pombe


Alignment Length:226 Identity:61/226 - (26%)
Similarity:110/226 - (48%) Gaps:18/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHII-AIHDSPRRLLPDKHYLCVMASDTPDQNLSQYFS 68
            :.::...||:.:::.:.:........|.:.: |:..:|...:|::.:|.:...|:..||:.|||.
pombe    47 LSEISKNLYISSWKTASELVSTSDKGIDYTLSAMSINPNLSVPEQQHLWLQIEDSSSQNILQYFE 111

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            ..|.||..|..:...||:||.||:|||||:..||:|...:.|.:|||..:...|:..:|||.|..
pombe   112 KSNKFIAFALSKNAKVLVHCFAGISRSVTLVAAYLMKENNWNTEEALSHINERRSGISPNANFLR 176

  Fly   134 QLQEFEQ--FKLSEERRRLRE----RFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCS-RG 191
            ||:.:.:  ::|....|..|:    |:...|:.   .|:|.:.: .|.|.::.|   .|... |.
pombe   177 QLRVYFECNYQLDRSLRPYRQWLFRRYGDFAVL---NTRVPSEV-AYAETVRAR---AGQLELRC 234

  Fly   192 EKCPTGVCNMDPTKGLFRRRPSNASTHSRLR 222
            :||...:.:.|   .|....|.:.:.:|..|
pombe   235 KKCRFVLASSD---YLVSHEPKDENNYSHTR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 42/134 (31%)
SPBC17A3.06NP_595588.1 CDC14 18..201 CDD:225297 45/153 (29%)
DSPc 47..181 CDD:238073 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1042
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.