DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and pmp1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_595205.1 Gene:pmp1 / 2540019 PomBaseID:SPBC1685.01 Length:278 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:57/240 - (23%)
Similarity:93/240 - (38%) Gaps:77/240 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NYRDSKDHAQLERF---KISHIIAIHDSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAA 77
            :|||||.:..::.|   :..||...||:...|..||              |..:.:     .:|.
pombe   103 HYRDSKHNLDIQVFDHIEYVHIHWDHDTQFALELDK--------------LVSFVA-----YNAM 148

  Fly    78 RLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFK 142
            :|.: .|||:|..|:|||..:.:|:||...:||..:|.:.|:.......||.....||.|::|. 
pombe   149 QLNK-KVLINCQMGISRSACLMIAFIMKTLNLNVSDAYEYVKERSPWIGPNMSLIFQLSEYQQI- 211

  Fly   143 LSEERRRLRER-----FPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVCNMD 202
                   :|:.     :.||:|:|..|..                  |||.              
pombe   212 -------IRKNSSQGPYQSSSLKQSKRKS------------------EGNL-------------- 237

  Fly   203 PTKGLFRRRPSNA-----STHSRLRAQSSNANASSSSLSVSSAAA 242
                ||..:|.:|     |..:...:..:|...:.||.|:|:.|:
pombe   238 ----LFPEKPHSAQLPLVSPSTSESSMFTNLRRTRSSGSISNDAS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 36/125 (29%)
pmp1NP_595205.1 CDC14 35..227 CDD:225297 40/151 (26%)
DSPc 61..209 CDD:238073 36/125 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.