DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Dusp7

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_703189.3 Gene:Dusp7 / 235584 MGIID:2387100 Length:422 Species:Mus musculus


Alignment Length:141 Identity:54/141 - (38%)
Similarity:83/141 - (58%) Gaps:11/141 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPD--KH-----YLCVMASDTPDQNLS 64
            ::||.||:|..:||.:...|.::.|.:|:.:  :|.  ||:  :|     |..:..||...||||
Mouse   250 QILPYLYLGCAKDSTNLDVLGKYGIKYILNV--TPN--LPNAFEHGGEFTYKQIPISDHWSQNLS 310

  Fly    65 QYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNA 129
            |:|.....||..||.::..||:|||||:||||||.|||:|...:|:..:|...|:..::..:||.
Mouse   311 QFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNF 375

  Fly   130 GFQSQLQEFEQ 140
            .|..||.:||:
Mouse   376 NFMGQLLDFER 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 52/138 (38%)
Dusp7NP_703189.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
DSP_MapKP 58..189 CDD:238723
Interaction with MAPK1. /evidence=ECO:0000269|PubMed:27783954 105..106
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..243
CDC14 232..396 CDD:225297 54/141 (38%)
DSPc 248..385 CDD:238073 52/138 (38%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q16829 334..340 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.