DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and ZK757.2

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_499190.2 Gene:ZK757.2 / 191421 WormBaseID:WBGene00014074 Length:294 Species:Caenorhabditis elegans


Alignment Length:299 Identity:70/299 - (23%)
Similarity:125/299 - (41%) Gaps:57/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPR-RLLPDKH----YLCVMASDTPDQNLSQY 66
            ::.|.|||.......... |.||    .:.|:..|. ||....|    :|.:..::|.|  ||.:
 Worm    16 QIRPYLYVSGLAALSPRV-LSRF----CVCINLIPGFRLSAPPHMKVVHLPLQDNETTD--LSPH 73

  Fly    67 FSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGF 131
            ::.....|..||...|..|:.|..|:|||.|..:||:|........::.|.|:..|.:..||.||
 Worm    74 WANVYKEIEEARKGAGRALLLCAMGISRSATFGIAYVMQYEKKTLHDSYKAVQLARNIICPNVGF 138

  Fly   132 QSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATAL--DNYQELLQNRDICEGNCSRGEKC 194
            ..||.:.||        :||.:.....:|.|...||...:  :.|.|::.       :.|:.::.
 Worm   139 FQQLIDLEQ--------KLRGKVSCKIIEPLPGCKVPDVIWQELYDEMIM-------SMSQDDRH 188

  Fly   195 PTGVCNMDPTKGLFRRRPSNASTHSRLRAQSSN-ANASSSSLS--------VSSAAAQSCPTSPK 250
            ....||:.          :.::|:..:..:|.| .|.:|.||:        :.::.....|:|..
 Worm   189 SLASCNLS----------ARSTTNDTMSLRSLNMVNDTSRSLASFHLTHRPIGASPTLLVPSSSS 243

  Fly   251 NS----PLPIVRRSVGNERIPEDEIVLEQPPTTSREAAE 285
            :|    |:|:.|   .:...|::..:|  |.:..|:.::
 Worm   244 SSSVRGPIPLQR---AHTEPPKEASIL--PKSALRDKSK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 40/136 (29%)
ZK757.2NP_499190.2 DSPc 14..148 CDD:214551 42/146 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.