DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and DUSP9

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_011529425.1 Gene:DUSP9 / 1852 HGNCID:3076 Length:415 Species:Homo sapiens


Alignment Length:148 Identity:58/148 - (39%)
Similarity:85/148 - (57%) Gaps:11/148 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLP-------DKHYLCVMASDTPDQNLS 64
            ::||.||:|:.|||.:...|.:..|.:|:.:  :|.  ||       |.||..:..||...||||
Human   237 QILPNLYLGSARDSANLESLAKLGIRYILNV--TPN--LPNFFEKNGDFHYKQIPISDHWSQNLS 297

  Fly    65 QYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNA 129
            ::|....:||..|..:...||:|||||:||||||.|||:|...||:..:|..:|:..::..:||.
Human   298 RFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNF 362

  Fly   130 GFQSQLQEFEQFKLSEER 147
            .|..||.:||:....|||
Human   363 NFMGQLLDFERSLRLEER 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 53/138 (38%)
DUSP9XP_011529425.1 DSP_MapKP 38..169 CDD:238723
CDC14 224..373 CDD:225297 54/139 (39%)
DSPc 235..372 CDD:238073 53/138 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1042
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.