DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and DUSP1

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_004408.1 Gene:DUSP1 / 1843 HGNCID:3064 Length:367 Species:Homo sapiens


Alignment Length:169 Identity:48/169 - (28%)
Similarity:81/169 - (47%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIH-DSPRRLLPDKHYLCVMASDTPDQNLSQYFSVC 70
            ::||.||:|:...:.....|:...|:.:|.:. :.|........|..:...|....::|.:|:..
Human   176 EILPFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA 240

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            .|||.:.:...|.|.:||.||:|||.|:.:||:|....:...||.:.|:..|::.:||..|..||
Human   241 IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 305

  Fly   136 QEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNY 174
            .:||...|:.   .......|.|:..|||....|.:.|:
Human   306 LQFESQVLAP---HCSAEAGSPAMAVLDRGTSTTTVFNF 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 38/132 (29%)
DUSP1NP_004408.1 DSP_MapKP 7..136 CDD:238723
DSP_DUSP1 174..324 CDD:350486 41/150 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.