DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and C24F3.2

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_501870.1 Gene:C24F3.2 / 177903 WormBaseID:WBGene00007697 Length:272 Species:Caenorhabditis elegans


Alignment Length:206 Identity:50/206 - (24%)
Similarity:90/206 - (43%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGKVLPGLYVGNY-----RDSKDHAQLERFKISHIIAIHDSP---RRLLPDKHYLCVMASDTPDQ 61
            |.|:...||:...     ..||.  :..:..|..::.:...|   ::.:....|..:...|.||:
 Worm     1 MWKITENLYLAQLPMIVGPTSKQ--EFSKNDIKRVLTLTTEPISEKQKIGGVDYKFLHLLDMPDE 63

  Fly    62 NLSQYFSVCNDFIHAARL-------REGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVR 119
            .:     :.|..:..|.|       :|.||.:||||.:||||::..||:|.......::|||::.
 Worm    64 PI-----LDNAILETAVLYINEGVEKEENVGVHCLAAVSRSVSICAAYLMYKNQWPVEKALKMIE 123

  Fly   120 AGRAVANPNAGFQSQLQEFEQFKLS---EERRRLRERFPSSALEQL----------DRTKVATAL 171
            :.|....|||||.:||:.:|:..:|   ::.:.|:...|.......          |:|||....
 Worm   124 SVRKTIGPNAGFLAQLKIWERSGMSFSADQYKNLKIDIPGITCVDSKTIWRQPVIDDQTKVRFKC 188

  Fly   172 DNYQELLQNRD 182
            ...::::.|.|
 Worm   189 RQCRKVIFNSD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 40/148 (27%)
C24F3.2NP_501870.1 DSPc 3..143 CDD:238073 39/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1042
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.