DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and Epm2a

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001263691.1 Gene:Epm2a / 114005 RGDID:71047 Length:331 Species:Rattus norvegicus


Alignment Length:173 Identity:38/173 - (21%)
Similarity:65/173 - (37%) Gaps:42/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAI-------------------HDSPRRLLPD-- 47
            |..::||.:::|:.....:|..:   |:.|.:.|                   :..|..:.||  
  Rat   156 HYSRILPNIWLGSCPRQLEHVTI---KLKHELGITAVMNFQTEWDIIQNSSGCNRYPEPMTPDTM 217

  Fly    48 -KHY----LCVMASDTPD-------QNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAV 100
             |.|    |..:...|||       |.|.|  :||  .:||.......|.:||.||:.||.....
  Rat   218 MKLYKEEGLAYIWMPTPDMSTEGRVQMLPQ--AVC--LLHALLENGHTVYVHCNAGVGRSTAAVC 278

  Fly   101 AYIMTATHLNWKEALKVVRAGRAVA--NPNAGFQSQLQEFEQF 141
            .::......:.::....:.|.|...  :..|..|:|...|::|
  Rat   279 GWLHYVIGWSLRKVQYFIMAKRPAVYIDEEALAQAQQDFFQKF 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 36/169 (21%)
Epm2aNP_001263691.1 CBM20_laforin 1..129 CDD:99881
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95278 103..107
PTPc 158..304 CDD:304379 32/152 (21%)
Glucan phosphatase signature motif CXAGXGR. /evidence=ECO:0000250|UniProtKB:O95278 266..272 3/5 (60%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95278 267..272 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.