DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and LOC108179554

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_017206934.2 Gene:LOC108179554 / 108179554 -ID:- Length:644 Species:Danio rerio


Alignment Length:205 Identity:42/205 - (20%)
Similarity:81/205 - (39%) Gaps:69/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKHYLCVMASDTPD--------- 60
            :.:|.|.:::.:.:.:::.|:|::..|:||:       ..:|    |.:...:..|         
Zfish   471 VSEVWPNVFIADEKTARNKAKLKKMNITHIV-------NAVP----LSLKEEEWKDYYQKKNITY 524

  Fly    61 ------------QNLSQYFSVCNDFIHAARLREGN-VLIHCLAGMSRSVTVAVAYIMTATHLNWK 112
                        .|::|.||...:|:|.|.....| ||::|..|:::||.:.:||:|....:..:
Zfish   525 YNVRSGLGVQGWPNIAQLFSPAAEFLHKALSDTKNKVLLYCSEGLNQSVVLFMAYLMIHQRMKLE 589

  Fly   113 EALKVVRAGRAVANPNAGFQSQLQEFEQFKLSEERRRL---RERFPSSALEQLDRTKVATALDNY 174
            ||                          |:...||||:   |:......:..||..|:       
Zfish   590 EA--------------------------FEFVLERRRMWISRDYLNQLVMLNLDLAKL------- 621

  Fly   175 QELLQNRDIC 184
            :||.:.|..|
Zfish   622 RELNECRPCC 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 29/155 (19%)
LOC108179554XP_017206934.2 FtsK <104..>252 CDD:332908
PTPc 282..427 CDD:328744
PTPc 470..604 CDD:328744 34/169 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.