Sequence 1: | NP_001261803.1 | Gene: | CG10089 / 39517 | FlyBaseID: | FBgn0036369 | Length: | 447 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017206934.2 | Gene: | LOC108179554 / 108179554 | -ID: | - | Length: | 644 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 42/205 - (20%) |
---|---|---|---|
Similarity: | 81/205 - (39%) | Gaps: | 69/205 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKHYLCVMASDTPD--------- 60
Fly 61 ------------QNLSQYFSVCNDFIHAARLREGN-VLIHCLAGMSRSVTVAVAYIMTATHLNWK 112
Fly 113 EALKVVRAGRAVANPNAGFQSQLQEFEQFKLSEERRRL---RERFPSSALEQLDRTKVATALDNY 174
Fly 175 QELLQNRDIC 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10089 | NP_001261803.1 | DSPc | 4..139 | CDD:238073 | 29/155 (19%) |
LOC108179554 | XP_017206934.2 | FtsK | <104..>252 | CDD:332908 | |
PTPc | 282..427 | CDD:328744 | |||
PTPc | 470..604 | CDD:328744 | 34/169 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |